PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G306200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 478aa    MW: 51588.2 Da    PI: 4.6676
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G306200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS193.91e-591104752374
                GRAS   2 velLlecAeavssgdlelaqalLarlsel......aspdgd.......pmqRlaayfteALaarlarsvselykalppsetseknsseela 79 
                          +lL++ A+av+s+d   a+a+L+rl +l      +    +       p   la yf+++L++r+++    + +  ++ ++     ++++ 
  Sevir.7G306200.1.p 110 SDLLVAGARAVASQDSISASAILSRLDDLipgvpyR----SchhaaasPSDHLACYFARGLRSRISGAR--TERHAAAAPA----PENRMP 190
                         679************************998754442....233334449******************33..3333333333....356899 PP

                GRAS  80 alklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetger.Lak 167
                         a+++++e+sP++kf+h+taNqaIlea++ +  vH++D+++++G+QW++L+  La   ++p +  +T+v+ ++    ++   + ++ r L++
  Sevir.7G306200.1.p 191 AYRMLQELSPFIKFAHFTANQAILEATADDPGVHVVDLNVGEGVQWASLMSDLARHGGKPFH--LTAVVTAAGAesDTAGAHPMAARwLSE 279
                         ******************************************************86555545..566666444345666666666555*** PP

                GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe...adhnsesFle 255
                         fAe+l++pf+    + +  edl+  + + + g +++V++    ++      sl   + ++L  vk l Pk+v+++eqe   + ++ ++F+e
  Sevir.7G306200.1.p 280 FAESLNLPFRSL--HLRGEEDLHGFTASGNGGGSVIVSCDTTDKSYS----SLIRLQMQLLGSVKILHPKLVILIEQElfrIGRSPAPFAE 364
                         *******98755..55777888888888888********99554443....4444556********************5444556679*** PP

                GRAS 256 rflealeyysalfdsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                          f+e l++++a+++sle+ +           vE+e lg+ ++++v + g+          +  +  e  GF++ +ls++++ q k+l   +
  Sevir.7G306200.1.p 365 FFCEVLQHFAAMLESLESCFCDGGygACLGLVEKETLGPMVEDAVGQYGSL---------TGGAVAELEGFRTCELSSFNVVQGKMLAGLF 446
                         ****************999988877788899*******************8.........224567889********************** PP

                GRAS 345 ksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         + +g+ v +e+g l l+W++rpL+svS+Wr
  Sevir.7G306200.1.p 447 G-RGFGVVQEEGRLALCWNSRPLTSVSVWR 475
                         *.***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098527.50883456IPR005202Transcription factor GRAS
PfamPF035143.5E-57110475IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
METMSYPCSP LISFPTQHEE SSYLLWSPQV LIPLSLENGD GDADPSSDHH QQQDHEVMDM  60
LIQEANRLPL QDELSNGDPL FTGFDQRREG QENGSLLAVQ EEFMAESSLS DLLVAGARAV  120
ASQDSISASA ILSRLDDLIP GVPYRSCHHA AASPSDHLAC YFARGLRSRI SGARTERHAA  180
AAPAPENRMP AYRMLQELSP FIKFAHFTAN QAILEATADD PGVHVVDLNV GEGVQWASLM  240
SDLARHGGKP FHLTAVVTAA GAESDTAGAH PMAARWLSEF AESLNLPFRS LHLRGEEDLH  300
GFTASGNGGG SVIVSCDTTD KSYSSLIRLQ MQLLGSVKIL HPKLVILIEQ ELFRIGRSPA  360
PFAEFFCEVL QHFAAMLESL ESCFCDGGYG ACLGLVEKET LGPMVEDAVG QYGSLTGGAV  420
AELEGFRTCE LSSFNVVQGK MLAGLFGRGF GVVQEEGRLA LCWNSRPLTS VSVWRPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-241134758375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL7139063e-59AL713906.3 Oryza sativa chromosome 12, . BAC OJ1587_D05 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149683e-59AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978326.20.0PREDICTED: nodulation-signaling pathway 2 protein-like
TrEMBLK3YE270.0K3YE27_SETIT; Uncharacterized protein
STRINGSi012487m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76843250
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.17e-38GRAS family protein